PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 252aa    MW: 28503.8 Da    PI: 6.4462
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20212genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-09141184447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT  E++l++++   +G g+Wk I++++ +++t  q+ s+ qky
         EMT20212 141 WTIGEHKLFLRGLGVYGRGDWKNISKHFVTTKTHVQVSSHAQKY 184
                      9999***************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.246133189IPR017930Myb domain
SuperFamilySSF466891.56E-14135190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-8136194IPR009057Homeodomain-like
SMARTSM007172.3E-5137187IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.5E-12138187IPR006447Myb domain, plants
PfamPF002495.2E-7141184IPR001005SANT/Myb domain
CDDcd001672.97E-5141185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MDPLVNQGWT SSEEEEARSV IVGHNSHTIV YDDKNKRHNN IVDALHELFP SKTRQQEIGA  60
SNICGINTMG DHVIDGYGVR EEEEAATMND NELIFGHALE DTRITETKEA PLMVDKNKMQ  120
ILENNITSDQ PAVPPRQGRF WTIGEHKLFL RGLGVYGRGD WKNISKHFVT TKTHVQVSSH  180
AQKYFRRLHK RASFGTQRYS INDVGLHDED PWSMNNSSGP SQMLGSTGLN NETSFGLQAP  240
DFCLHYKIVI TQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR7WC650.0R7WC65_AEGTA; Myb-like protein J
STRINGMLOC_10538.21e-120(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.16e-18Homeodomain-like transcriptional regulator